Product name: Growth hormone-releasing factor
Synonyms:,GRF, , Somatoliberin GHRH,Somatocrinin,Somatorelin, Growth hormone-releasing hormone
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Modifications: c-terminal amide
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Growth hormone-releasing hormone (GHRH) is a hypothalamic peptide that regulates the secretion of GH from the pituitary by an action exerted on the hypophyseal receptors for GHRH. GHRH, in addition to stimulating GH secretion from the pituitary, exerts survival and antiapoptotic effects in different cell types. Moreover, we and others have recently shown that GHRH displays antiapoptotic effects in isolated cardiac myocytes and protects the isolated heart from ischemia/reperfusion injury and myocardial infarction in vivo.
Uniprot ID: P01286
Compound ID: 44134750
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Endocrinology. 2015 Sep;156(9):3239-52.
Endokrynol Pol. 2015;66(2):137-41.
Gen Comp Endocrinol. 2014 Apr 1;199:38-45.
Endocrinology. 2013 Apr;154(4):1624-35.
Eur J Endocrinol. 2005 Apr; 152(4):575-80.
Proc Natl Acad Sci U S A. 2004 Feb 10;101(6):1708-13.
Ann Oncol. 2001; 12 Suppl 2:S89-94.
Acta Paediatr Scand Suppl. 1987; 331:42-7.