Product name: Corticotropin-releasing hormone

Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Modifications: c-terminal amide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Corticotropin-releasing factor (CRF), a 41 amino acidcontaining peptide, appears to mediate not only the endocrine but also the autonomic and behavioral responses to stress. Increasing evidence suggests that placental corticotropin-releasing hormone may have evolved in primates to stimulate fetal adrenocorticotropin release and adrenal steroidogenesis, thus satisfying the high demand for synthesis of dehydroepiandrosterone, the predominant source of placental estradiol.

Uniprot ID: P06850

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Psychiatry Research, Volume 210, Issue 2, 15 December 2013, Pages 662-664

Brain Research, Volume 1392, 25 May 2011, Pages 27-46

General and Comparative Endocrinology, Volume 174, Issue 3, 1 December 2011, Pages 287-291

PNAS; 2004,June 1, 101 (22): 8503–8508

American Journal of Obstetrics and Gynecology, Volume 180, Issue 1, Supplement 2, January 1999, Pages S242-S246

Journal of Endocrinology (1999) 160, 1–12