´ëÇѹα¹ ¿¬±¸ÀںеéÀÇ µ¿¹ÝÀÚ°¡ µÇ°Ú½À´Ï´Ù. ´Ù¾çÇÑ ÆéŸÀÌµå ¶óÀ̺귯¸® Á¤º¸¸¦ °øÀ¯µå¸³´Ï´Ù.

ÇÏ´Ü¿¡ »ó¼¼¿µ¿ªº° Ä«Å×°í¸®¸¦ ´­¸£½Ã¸é º¸´Ù ½±°Ô ¿øÇÏ´Â Á¦Ç°À» ãÀ»¼ö ÀÖ½À´Ï´Ù. We will be your companion with our high technology and sufficent Know -how. If press below, You could easily find out several kinds of related informations.


Ä«Å×°í¸® Natriuretic Peptide
CAT.NO
PRODUCT Dendroaspis natriuretic peptide
Size
Price

Product name: Dendroaspis natriuretic peptide

Sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA

Modifications: disulfide(7-23),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Dendroaspis natriuretic peptide (DNP) , which was isolated from the venom of the green mamba (Dendroaspis angusticeps), having greater potency and increased stability as compared to the mammalian family members.DNP is the most potent natriuretic peptide to cause lower esophageal sphincter relaxation, which might be mediated by natriuretic peptide receptor-A or a novel DNP-selective natriuretic peptide receptor.

Uniprot ID: P28374

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reference:

Kidney Int. 1999 Aug; 56(2):502-8.

Hypertension. 2001 Apr; 37(4):1089-94.

Circ Res. 2006 Jul 21; 99(2):183-90.

Toxicon. 2012 Mar 15;59(4):434-45.


Turk Neurosurg. 2014;24(1):38-43.

÷ºÎÆÄÀÏ

¸Þ´º´Ý±â

°ßÀû¹®ÀÇ

INQUIRY

¾Æ·¡ Ç׸ñ¿¡ ¸Â°Ô Á¤È®È÷ ÀÔ·ÂÇÏ¿© ÁֽʽÿÀ.