Product name: SCR/SP11

Synonyms: Defensin-like protein A,AtSCRA,S locus cysteine-rich-like protein A,S locus protein 11,

Sequence: QKWNKCFLRDIFPGKCEHDANAKLRCKEDDAKKTLA

Modifications: disulfide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The S-locus cysteine-rich protein SCR, also known as SP11, is a basic protein of approximately 6kDa, which was identified in members of the Brassicaceae that exhibit self-incompatibility (SI). SI is a genetic system that prevents self-pollination by disrupting the early events of the interaction between pollen grains and the epidermal cells of the stigma, a specialized structure that caps the female reproductive apparatus.

Uniprot ID: P0CG07

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Handbook of Biologically Active Peptides, 2006, Pages 41-47,VI.