Product name: DVL1

Synonyms: Protein rotundifolia like 18,

Sequence: MEMKRVMMSSAERSKEKKRSISRRLGKYMKEQKGRIYIIRRCMVMLLCSHD

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The DEVIL (DVL) or ROT-FOUR-LIKE (RTFL) family of small proteins was discovered during activation-tagging screens in Arabidopsis. Overexpression of several of these genes results in similar pleiotropic phenotypes: shortened rosette leaves and floral organs, altered silique development, and stalks at the base of pedicels and trichomes. DVL/RTFL overexpression alters a large number of genes involved in signaling pathways, particularly in hormonal responses.

Uniprot ID: Q6X5V0

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Handbook of Biologically Active Peptides (Second Edition), 2013, Pages 15-19.

Handbook of Biologically Active Peptides, 2006, Pages 17-22,III.