Product name: NtRALF

Synonyms: Rapid alkalinization factor,RALF,

Sequence: ATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCSAITRCRS

Modifications: disulfide(1-2,3-4),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Rapid Alkalinization Factor (RALF) is a 49-amino acid peptide initially isolated from tobacco leaves that is capable of arresting both root and pollen tube growth. With suspension cells, addition of RALF causes an elevation of the pH of the extracellular media, caused by the blockage of a proton pump. RALF associates with a putative receptor(s) on the surface of the plant cell, initiating a signal transduction pathway.

Uniprot ID: Q945T0

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Handbook of Biologically Active Peptides (Second Edition), 2013, Pages 46-49.

Peptides, Volume 31, Issue 11, November 2010, Pages 1973-1977.