Product name: Exendin (9–39)

Synonyms: GLP-1 receptor agonist,

Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Exendin-4 (Ex-4), a long-acting agonist of glucagon-like peptide-1 receptor, is a novel anti-diabetic drug that prevents β-cells against various toxicities. The GLP-1 receptor antagonist, exendin (9–39), antagonised emesis and c-Fos expression in the brainstem and the paraventricular hypothalamus induced by the chemotherapeutic drug cisplatin (30 mg/kg, i.p.; p < 0.05), but not the emesis induced by nicotine (5 mg/kg, s.c.; p > 0.05), or copper sulphate pentahydrate (120 mg/kg, p.o.; p > 0.05).

Uniprot ID:

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Neuropharmacology, Volume 83, August 2014, Pages 71-78