Product name: Exendin-4

Synonyms: GLP-1 receptor agonist,Exenatide,

CAS NO.: 141758-74-9

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Modifications:

M.W: 4186.6

M.F.: C184H282N50O60S

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Exendin-4 (Ex-4), a long-acting agonist of glucagon-like peptide-1 receptor, is a novel anti-diabetic drug that prevents β-cells against various toxicities. GLP-1 receptor agonist Ex-4 improves glucose homeostasis, shows antiobesity activity, without causing harmful side effects like fatty liver.

Uniprot ID:

Drug Bank ID: http://www.drugbank.ca/drugs/DB01276

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Peptides, Volume 37, Issue 1, September 2012, Pages 18-24

Molecular and Cellular Endocrinology.Volume 362, Issues 1–2, 15 October 2012, Pages 242–252

European Journal of Pharmacology, Volume 714, Issues 1–3, 15 August 2013, Pages 188-192

Biochemical and Biophysical Research Communications.Volume 434, Issue 1, 26 April 2013, Pages 150–154

European Journal of Pharmacology, Volume 699, Issues 1–3, 15 January 2013, Pages 106-111

Acta Biomaterialia, Volume 10, Issue 2, February 2014, Pages 812-820

Nuclear Medicine and Biology, Volume 40, Issue 8, November 2013, Pages 1006-1012

Pharmacological Research, Volume 84, June 2014, Pages 18-25

Nuclear Medicine and Biology, Volume 41, Issue 6, July 2014, Pages 471-476

Regulatory Peptides, Volumes 190–191, May 2014, Pages 1-11