Organism: Human

Synonyms: GLP-1(7-37), GLP-1 [7-37]

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: GLP-1 regulates glucose homeostasis by stimulating insulin secretion, inhibiting glucagon release, and delaying gastric emptying. Intravenous GLP-1 has been shown to increase insulin secretion in response to elevated glucose levels and offers therapeutic benefit for patients with type 2 diabetes. GLP-1 is of relevance to appetite and weight maintenance because it has actions on the gastrointestinal tract as well as the direct regulation of appetite.

Uniprot ID: P01275

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Diabet Med. 1998 Nov; 15(11):937-45.

J Clin Endocrinol Metab. 2003 Apr; 88(4):1772-9.

Eur J Med Chem. 2004 Jun; 39(6):473-80.