Product name: Glucagon-like peptide 1(7-36) amide

Organism: Human

Synonyms: GLP-1[7-36 amide], GLP-1(7-36),Insulinotropin (human), Preproglucagon 78-107 Amide,

CAS NO.: 107444-51-9

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Modifications: C-terminal amide,

M.F.: C149H226N40O45

M.W: 3297.63

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Glucagon-like peptide 1 (7–36) amide (GLP-1) and exendin-4 are gastrointestinal hormones as well as neuropeptides involved in glucose homeostasis and feeding regulation, both peripherally and at the central nervous system (CNS), acting through the same GLP-1 receptor. Administration of intravenous GLP-1 (7-36) amide to patients undergoing cardiac surgery significantly reduced their plasma glucose levels intraoperatively and may represent a novel therapeutic strategy to prevent perioperative hyperglycemia.

Compound ID: 16133831

Uniprot ID: P01275

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Crit Care Med. 2014 Mar;42(3):638-45.

Chem Biol Interact. 2013 Apr 25; 203(2):530-41.

Cell Metab. 2011 Nov 2; 14(5):700-6.

Acta Diabetol. 1998 Oct; 35(3):117-29.

Diabetologia. 1996 Dec; 39(12):1546-53.