Product name: Glucagon-like peptide 1

Organism: Human

Synonyms: GLP-1,Incretin hormone,Glucagon-like peptide 1, Glucagon-like peptide-1, Glucagon-like-peptide-1, Glucagon-related peptide I, Proglucagon (72-108),

CAS NO.: 89750-14-1

Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Modifications:

M.F.: C149H226N40O45

M.W.: 3297.63

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: GLP-1 regulates glucose homeostasis by stimulating insulin secretion, inhibiting glucagon release, and delaying gastric emptying. Intravenous GLP-1 has been shown to increase insulin secretion in response to elevated glucose levels and offers therapeutic benefit for patients with type 2 diabetes. GLP-1 is of relevance to appetite and weight maintenance because it has actions on the gastrointestinal tract as well as the direct regulation of appetite.

Compound ID: 16135499

Uniprot ID: P01275

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Analytical Biochemistry. Volume 472, 1 March 2015, Pages 45–51.

Metabolism. 2014 Jan; 63(1):9-19.

Diabetes. 2014 Jan; 63(1):101-10.

Gastroenterology. 2011 Jul; 141(1):150-6.

Curr Top Med Chem. 2011;11(12):1447-63.

J Clin Endocrinol Metab. 2010 May; 95(5):2367-75.

Physiol Rev. 2007 Oct; 87(4):1409-39.

Int J Obes Relat Metab Disord. 2001 Dec; 25 Suppl 5:S42-7.