Product name: Oxyntomodulin
Organism: Human
Synonyms: OXM,OXY,
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Oxyntomodulin (OXM) is a peptide hormone released from the gut in post-prandial state that activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) resulting in superior body weight lowering to selective GLP1R agonists. OXM reduces food intake and increases energy expenditure in humans.
Uniprot ID: P01275
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Peptides, Volume 7, Supplement 1, 1986, Pages 253-256
European Journal of Pharmacology, Volume 203, Issue 2, 15 October 1991, Pages 245-252
Journal of Chromatography B, Volume 903, 15 August 2012, Pages 102-111
Biochimie, Volume 95, Issue 2, February 2013, Pages 264-270
Molecular Metabolism. Volume 3, Issue 3, June 2014, Pages 241–251