Product name: Oxyntomodulin

Organism: Human

Synonyms: OXM,OXY,

Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Oxyntomodulin (OXM) is a peptide hormone released from the gut in post-prandial state that activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) resulting in superior body weight lowering to selective GLP1R agonists. OXM reduces food intake and increases energy expenditure in humans.

Uniprot ID: P01275

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Peptides, Volume 7, Supplement 1, 1986, Pages 253-256

European Journal of Pharmacology, Volume 203, Issue 2, 15 October 1991, Pages 245-252

Journal of Chromatography B, Volume 903, 15 August 2012, Pages 102-111

Biochimie, Volume 95, Issue 2, February 2013, Pages 264-270

Molecular Metabolism. Volume 3, Issue 3, June 2014, Pages 241–251