Product name: Gastric inhibitory polypeptide

Organism: Human

Synonyms: GIP,Glucose-dependent insulinotropic polypeptide,Incretin hormone

Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The 42 amino acid polypeptide gastric inhibitory polypeptide (GIP) is released from intestinal K-cells in response to nutrient ingestion. It is also named glucose-dependent insulinotropic polypeptide and is actually considered to be the main incretin factor of the entero-insular axis.

Uniprot ID: P09681

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Int J Mol Sci. 2014 Apr 1;15(4):5596-622.

Vitam Horm. 2009; 80:409-71.

Mol Endocrinol. 2006 Jul;20(7):1644-51.

Diabetes. 2004 Dec;53 Suppl 3:S190-6.

Nat Med. 2002 Jul; 8(7):738-42.

J Mol Endocrinol. 1989 May;2(3):169-74.