Product name: Neuropeptide F(NPF)

Organism: Whiteleg shrimp

Sequence: KPDPSQLANMAEALKYLQELDKYYSQVSRPRF

Modifications: C-terminal amide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The neuropeptide Fs (NPFs) are an invertebrate subgroup of the FMRFamide-like peptides, and are proposed by some to be the homologs of vertebrate neuropeptide Y. NPF-fed shrimp also showed a significant increase in growth relative to the control group. Our data suggest that NPF is present in both the nervous system and midgut of penaeid shrimp, functioning, at least in part, as a powerful orexigenic agent.

Uniprot ID: F6KM62

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Neuron. 2013 Oct 2;80(1):171-83.

Peptides. 2012 February; 33(2): 230–239.

J Exp Biol. 2011 April 15; 214(8): 1386–1396.