Product name: Hinnavin II

Sequence: KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG

Modifications: c-terminal amide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Hinnavins, together with lysozymes, are the main types of antibacterial peptides/proteins previously isolated from the larval haemolymph of the cabbage butterfly, Artogeia rapae as part of the humoral immune response to a bacterial invasion. One of these antibacterial peptides, named hinnavin II, was purified and characterized after cDNA cloning. The purified hinnavin II was more active against Gram negative than against Gram positive bacteria. Hinnavin II also showed a powerful synergistic effect on the inhibition of bacterial growth with purified lysozyme.

Uniprot ID: Q68KS5

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Comparative Biochemistry and Physiology Part B: Biochemistry and Molecular Biology.Volume 144, Issue 2, June 2006, Pages 199–205