Product name: HNP-1

Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Modifications: disulfide(1-6,2-4,3-5)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: human alpha-defensin-1, also designated as human neutrophil peptide 1 (HNP1), is a potent inhibitor towards several enveloped virus infecting mammals.

Uniprot ID: P59665

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Rheumatology (2013) 52 (8): 1368-1376.

European Journal of Pharmacology, Volume 715, Issues 1–3, 5 September 2013, Pages 420-423.


Journal of Molecular Biology, Volume 381, Issue 5, 19 September 2008, Pages 1281-1291.