Product name: Human Beta-defensin 2

Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Modifications: disulfide(1-5,2-4,3-6)

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Human β-defensin (HBD)-2 is an inducible antimicrobial peptide that plays an important role in innate immunity.

Uniprot ID: O15263

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Archives of Oral Biology, Volume 57, Issue 12, December 2012, Pages 1609-1614.

Peptides, Volume 38, Issue 2, December 2012, Pages 350-356.

Peptides, Volume 31, Issue 2, February 2010, Pages 195-201.

Journal of Endodontics, Volume 36, Issue 1, January 2010, Pages 64-69.

Journal of the American Academy of Dermatology, Volume 61, Issue 1, July 2009, Pages 58-65.