Product name: kaliocin-1

Sequence: FFSASCVPGADKGQFPNLCRLCAGTGENKCA

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Kaliocin-1 is a 31-residue peptide derived from human lactoferrin, and with antimicrobial properties that recapitulate those of its 611 amino acid parent holoprotein. Previous studies suggested that the mechanism by which kaliocin-1 exerts anti-candidal efficacy depends on mitochondrial perturbation without cell membrane permeabilization.

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Biochimica et Biophysica Acta (BBA) - Biomembranes, Volume 1768, Issue 11, November 2007, Pages 2862-2872.