Product name: Scarabaecin

Sequence: ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS

Modifications: disulfide,

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Chemically synthesized scarabaecin indicated antifungal activity against phytopathogenic fungi such as Pyricularia oryzae, Rhizoctonia solani, and Botrytis cinerea, but not against phytopathogenic bacteria.

Uniprot ID: Q86SC0

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Biochemical and Biophysical Research Communications, Volume 307, Issue 2, 25 July 2003, Pages 261-266