Product name:  taipan natriuretic peptide c

Sequence: SDSKIGNGCFGFPLDRIGSVSGLGCNRIMQNPPKKFSGE

Modifications: disulfide(9-25),

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: taipan natriuretic peptide c (TNPc), which was isolated from the venom of the inland taipan (Oxyuranus microlepidotus) displaying similar activity to ANP and DNP at rat natriuretic peptide receptor A.

Uniprot ID: P28374

Usage: For Scientific Research Use Only, Not for Human Use.

Reference:

Toxicon. 2012 Mar 15;59(4):434-45.

Biochem Biophys Res Commun. 2005 Feb 25;327(4):1011-5.