Product name: Big gastrin
Synonyms: Gastrin component II,Gastrin-34,G34,
Sequence: QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
Modifications: n-terminal Pyr,c-terminal amide
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is expressed in the embryonic pancreas and is common in islet cell tumors.
Uniprot ID: P01350
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Digestion. 1990;47 Suppl 1:11-6; discussion 49-52. Review.
PLoS One. 2013 Aug 5;8(8):e70397.
Biomark Med. 2014 Apr;8(4):571-80.