Product name: Cholecystokinin-33
Synonyms: CCK33,CCK-33,
Sequence: KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Modifications: Y27 sulfation,
Purity: 95% by HPLC
Counter ion: sulfate
Format: Lyophilized powder
Description: Cholecystokinin (CCK) controls nutrient delivery to the small intestine by inhibiting food intake and gastric emptying.
Uniprot ID: P06307
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Australas Radiol. 1994 Feb; 38(1):30-3.
Semin Nucl Med. 1996 Jan; 26(1):16-24.
Obes Rev. 2005 Nov; 6(4):297-306.
Curr Opin Endocrinol Diabetes Obes. 2012 Feb;19(1):8-12.
J Am Coll Surg. 2013 Aug;217(2):317-23.